DPCstruct | MC373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327XDZ8 | 2-76 | RIEVLGALLGDQVLVKSVSLLGVTYEAKEERIELMLKGITHVIDKPRKVSVQEDDGVVRAIEVVDGDERHQLLTF |
| A0A2V9PMX4 | 3-100 | FFDSFSWQHEGWLASVKVSQGSEQKWEVKERKLSGISSDHLTARDEIYITIDRDEGGQLTHPIKNPMKVVFRRDLEGAHEGIDVVSA… |
| A0A517T0H7 | 169-277 | None |
| A0A837II58 | 2-105 | None |
| A0A7Y5QYG4 | 165-280 | None |
| A0A7X9FEV4 | 1-123 | None |
| A0A7Y8HT12 | 4-135 | None |
| A0A3N5Q6S1 | 3-95 | None |
| A0A2V7XPH9 | 2-95 | None |
| A0A357F6T8 | 4-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.