DPCstruct | MC37294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 314 ± 61 aa |
| Standard deviation of domain lengths | 61.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0020- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1T5R3 | 1-349 | HNFNSVEEAGAWGDEDLEIDGVEVVDTQPVDQQDEFGNERSEDVVEGGYYVAPMPGPGRLVRWTRNAALAGELAAAGAVEEAMKLLS… |
| A0A1S3I493 | 164-367 | LVQRLQTAYQMTTQGKFAEAVDRFRSILLSVPLLVVDTKQEITEAQQLIEICREYIVGLSMELKRKEMPKENLEQQKRLCEMAAYFT… |
| L8HEI2 | 59-472 | None |
| A0A7F8RQJ6 | 257-671 | None |
| A0A5J4WKH5 | 473-813 | None |
| A0A820BYS4 | 81-504 | None |
| A0A1U8PNE3 | 72-374 | None |
| A0A498IXR9 | 37-280 | None |
| M5FZP2 | 226-478 | None |
| A0A843UBC8 | 376-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.