DPCstruct | MC37290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 148 |
|---|---|
| Mean domain length (aa) | 222 ± 48 aa |
| Standard deviation of domain lengths | 48.42 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | PF00303- CL0464 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2W4L0 | 252-475 | TPKADRTGTGTLSIFGHQMRFNLQEGFPLVTTKKCHLRSIIHELLWFLNGDTNIAYLKENKVTIWDEWADENGDLGPVYGKQWRSWA… |
| A0A4V7TQ14 | 5-181 | DMQYNTIINDIINNGVSDEEFDVRTKWDTDGTPAHTLSVISKQMRFDNSEVPILTTKKVAWKTSIRELLWIWQLKSNDVNELNKMGV… |
| A0A2N9IHI3 | 876-1100 | None |
| A0A2I4CU34 | 9-241 | None |
| A0A7K3J1F4 | 2-172 | None |
| A0A3D1PX04 | 11-160 | None |
| A0A1G1AD91 | 61-329 | None |
| A0A7X7VH88 | 26-215 | None |
| A0A0D0QJS8 | 15-216 | None |
| A0A7C5JSF6 | 15-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.