DPCstruct | MC3729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0NY13 | 58-143 | NVNNNALSEIKEEEKVKEALITESNILYVSVYDDGTRRDGYASYLCQILKEHKSLVRKVKVVKFGSHNDSKRDNAYGVLLGESDCN |
| A0A5S9NC12 | 11-114 | IIILLFSVCSTAQIRDFSTAHKKIERALEGRAGFPGSDAIWVAHNVLGITVIKDVINEKKYAKDVCNFLAENGFSSQKVTVNIVDQN… |
| A0A2E2KIL4 | 67-163 | None |
| A0A081G3L1 | 2-82 | None |
| Q72FI7 | 157-249 | None |
| A0A0B1ZWK6 | 17-121 | None |
| A0A7L7L8L6 | 68-175 | None |
| A0A1H2YXU8 | 59-173 | None |
| A0A2M7GLE6 | 8-100 | None |
| A0A2D7WCX4 | 8-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.