DPCstruct | MC37285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1192 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.02 |
| Pfam Score | 94.68 |
| Assigned Pfam label(s) | PF20240- CL0161- CL0029- PF12625- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831JEE2 | 23-144 | ATSFLEEISDLFAGAKRNENNIVERVVKYINENFEKEIRLKELSQTIYLNPEYFSRLFKKEVGCTYVEYLTRIRIEAAKKYLANPSL… |
| A0A6N8ZFW3 | 283-422 | DLPVEFTEYLAWRGLRVDRGTCDIIRRTVRLARHLTTIASLSRTIYLSRRALGRRFVSRGLPVPSHWLQFCRILHAVLRLQNSSQSL… |
| A0A160UFH5 | 177-317 | None |
| A0A3B0C3T5 | 402-529 | None |
| A0A7I0EF37 | 1-122 | None |
| A0A251WNU6 | 3-154 | None |
| A0A424L368 | 8-118 | None |
| A0A191ZSH2 | 125-249 | None |
| A0A1Y4HBV3 | 124-251 | None |
| A0A557R2S6 | 78-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.