DPCstruct | MC3728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5L2F4 | 245-355 | DFIKNNLKIGLLPADVENLLENNFTIVYAALDGQEMWRYDIFTIEDYVLENEYQTDSVDLDGILEGEISIQLFVGFDNDKKVSRYII… |
| A0A1D8JED4 | 2-105 | MKNAKEGLSAKEVKEVFGEPLLSDTVDSTETWLYSTPADDTDYKPSLEAVNHQAILDEVVDYELYINFLDNKAYIYSYFYKSGEDVR… |
| A0A161RX33 | 5-107 | None |
| A0A0A5G4N2 | 79-202 | None |
| A0A1I4LP66 | 289-408 | None |
| A0A7Z2VPV4 | 71-209 | None |
| I0BN20 | 419-547 | None |
| A0A2I0QS10 | 82-195 | None |
| K1KU10 | 22-140 | None |
| A0A4S4C3D9 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.