DPCstruct | MC37276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 95.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A486XS82 | 153-208 | SLVLTLGDGFDYREQAQNPANHLGKLVRLYADGSVPADNPFVAKTGYAAEVYSLGH |
| A0A6B0W9B4 | 244-305 | HWGGRLLFDRDGFLYFSIGDMSAAMNSQDPAMPSGKVFRIRPDGGIPDDNPFAGEDGALGAV |
| A0A2A2QQ31 | 248-309 | None |
| A0A6N8VAS6 | 163-233 | None |
| A0A7C7PER7 | 441-512 | None |
| A0A2D6RQ67 | 281-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.