DPCstruct | MC37274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 221 ± 43 aa |
| Standard deviation of domain lengths | 42.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P9WZG2 | 28-205 | EKKNLTPCNDYVCERIINARLRSLLLSKIFDFLVCEDITVVLSDEAFANARVVGDTHFLNNRIWEITLNTNALQQASQEYIAATIIH… |
| A0A0P0NK93 | 16-189 | TARNAKNTIRDMLNNTFSGNEYEDSDITFKDVTTLPDNIDGTSRQINSKIFEIELNKNKLLGRSKEYIVATVYHEVLHTYLDTKYPK… |
| A0A1I4Z7V9 | 239-476 | None |
| F4AVN3 | 363-571 | None |
| F4AVN0 | 52-286 | None |
| A0A7L4ZEY4 | 29-262 | None |
| M7MHC8 | 77-387 | None |
| A0A7K3N799 | 222-494 | None |
| A0A2S7WAZ6 | 117-357 | None |
| A0A426JGW6 | 30-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.