DPCstruct | MC37271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 54 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1TK10 | 205-257 | PPPTEPQGRWTLWRQDDNGNRVVVRVFSGLAKARAHLRRFEALHHRQIYWLEE |
| A0A517R807 | 1-59 | MNENISKEVADRCNNWSVWRQGDDGNRFLIEEELSEGAARQMVAEFEARGHKQLYWATR |
| A0A3T0VLS5 | 55-119 | None |
| A0A557QKE9 | 127-181 | None |
| A0A1A9A1I2 | 64-123 | None |
| A0A2T0JWH9 | 2-48 | None |
| A0A646KRK7 | 1-60 | None |
| A0A5B9P9Q8 | 2-47 | None |
| A0A2E0QW19 | 78-126 | None |
| A0A7Z9PRA3 | 2-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.