DPCstruct | MC3727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 202 ± 24 aa |
| Standard deviation of domain lengths | 23.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4LFH3 | 6-177 | FPFFDNNDSRGLFKDGWFASTFGPLTPWLTVSPGLATWDSSEDVWELYDLRGDFYQAENLADREPERLAAMKTEFLKVAEANKAFPI… |
| A0A813CBB8 | 642-877 | PEHVEGATQMPLDGVSMVYTWNNASAVGRKDTQYFEVMGSRGVYKDGWFASVFGPRIPWTGTNATRLKEWNPDTDVWELYDLTKDYS… |
| A0A1D8A8X6 | 413-646 | None |
| A0A7C4MT94 | 16-231 | None |
| A0A1V3WKX5 | 35-227 | None |
| A0A7Y5T6W0 | 195-430 | None |
| A0A812RWJ0 | 67-257 | None |
| F2AQN8 | 417-623 | None |
| A0A2D8LXI3 | 106-309 | None |
| A0A3G8JQ67 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.