DPCstruct | MC37266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 76.52 |
| Assigned Pfam label(s) | CL0004- CL0001- CL0422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401PM21 | 1-85 | MDRCLPNYCEHGGECSQSWSTFYCDCTGTGYTGATCHNSRYRQSCETYKHTGNTSGFFSIDPDGSGPQGPLLVYCNMTEDTTWTI |
| A0A3P7N116 | 42-128 | VGCYRSATIAFRCLPNPCENDAVCEQISLDDFKCHCPDSYYGKRCHATRRYRSCEAFFLGNAHIRRKNISIDLDGGNHLAPLTVQCE |
| A0A3B4GET7 | 419-505 | None |
| A0A5C6NUC4 | 110-205 | None |
| A0A484C885 | 350-425 | None |
| A0A2B4RV46 | 389-464 | None |
| A0A2B4R831 | 370-460 | None |
| A0A2B4REP4 | 7-87 | None |
| B0S7S0 | 542-622 | None |
| A0A3M6UFJ0 | 111-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.