DPCstruct | MC37263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 684 |
|---|---|
| Mean domain length (aa) | 122 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.10 |
| Pfam Score | 95.72 |
| Assigned Pfam label(s) | CL0092- PF08069- CL0472- PF04815- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3HI38 | 8-108 | IARSLQSSAGVRIWRIEKMEMEPVPQASYGNFYEGDCYIVLATRKIARSLCHDVYFWLGRQSSQDEQGAAAIYTTQIDDALQGAAVQ… |
| A0A1J4KDH9 | 4-126 | VSAPEIKEAYDEIRSEKETDWVFVKPSDGNPNKWVLHAKGSDGVAGLAASLDESILGYGYLRVKDGAGRTKFIFLQYVGPNAKRTVS… |
| A0A6J1X2W8 | 18-128 | None |
| A0A1X2IFE0 | 7-130 | None |
| A0A5B7BTV7 | 176-302 | None |
| A0A553N2G8 | 417-549 | None |
| A0A821QV75 | 7-112 | None |
| A0A5P1EV69 | 50-142 | None |
| A0A1Z5SAI4 | 71-155 | None |
| A0A1I8IK45 | 611-758 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.