DPCstruct | MC37260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 13.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0344- CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672KI78 | 48-117 | SASEDADSEAAGGVKLPCQLAMWDLGHCDPKRCTGRKLVRKGFVRCLRLNQRFNGLILSPMGAKYVTPAD |
| A0A5S6QPW5 | 2-89 | AAQSNTDTDLEESNGPSCSNSVKNGELEDKLIRLVLYDFNQCDAKKCSGRKLVRLKAVACLRMSTRFGGITLTPTARCCLKPEDKEII |
| A0A7E4RM17 | 35-119 | None |
| A0A7J6I9D3 | 1-95 | None |
| A0A023B5Q5 | 38-152 | None |
| A0A6A6K5X2 | 3-110 | None |
| A0A0G2I160 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.