DPCstruct | MC3726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1WYY1 | 31-160 | ECPRYYQSVSLLSSAGHTAIPSDKDEMLLKKWKRSSLWPTIEEQATSVSGAPERRKTFSNFCPEVAYDRFGLFASELYPYHDEIDHD… |
| A0A6L7W3R5 | 47-167 | STKISKEEDDRLLKKWEKTDLWPKTKEQATSIGGSDNNYHHFSNYCPEVAFERFGYFASSLARYADEIDMDNAHERLAKTGSTENDW… |
| A0A444JAM8 | 1-110 | None |
| A0A1F2RJX5 | 2-128 | None |
| A0A3N0V0I9 | 23-166 | None |
| A0A7C5F5C1 | 1-122 | None |
| A0A850MNL7 | 47-157 | None |
| A0A2N2K137 | 9-158 | None |
| A0A842VLW7 | 165-277 | None |
| X0SRN6 | 48-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.