DPCstruct | MC37257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 219 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0012- CL0465- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6VQ05 | 12-203 | NGQVTFLVTIGVFTVVILVLWRTVLLLPFKLITVFLHEASHAIACKLTCGHVEGIKVHADEGGVTQTRGGIYWVILPAGYLGSSFWG… |
| A0A427YIL6 | 27-274 | TFQTNTIIAACVMFIAILIAWNLPILRDIIAALKLFVVGIHEMCHLAVGLMCGGQIVSICIDPNDGGATHIMNLMRTFPRVPRDPYA… |
| A0A2U3ELT5 | 830-1076 | None |
| A0A7V4GHG3 | 69-298 | None |
| E6RG65 | 29-222 | None |
| R7W5L9 | 14-265 | None |
| A0A6B1E015 | 108-345 | None |
| A0A6L6CH80 | 37-262 | None |
| A0A6A2YQ61 | 3-192 | None |
| A0A834ZMF3 | 93-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.