DPCstruct | MC37254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 151 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 98.68 |
| Assigned Pfam label(s) | CL0125- PF00368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6VBT4 | 2-139 | ACSPSIVDHIIPTVSSAEDEEMVDLVVKGTIHSHALEEQVGDCKGAVRIRREALQRITRRSLQGLPLDGFDYGSILKQCCEMPVGYV… |
| Q2HEP4 | 3-107 | DFTRAVKIRRTIISRTKATADLTGVLERSKLPYQGYNWAQVHGACCENVIGYMPLPVGVAGPLVIDGQSYFIPMATTEGVLVASTSR… |
| A0A0V1A4Q6 | 264-420 | None |
| A0A453PE64 | 69-229 | None |
| A0A446XCL6 | 115-260 | None |
| A0A5N6G5Q8 | 303-471 | None |
| A0A6A2XYC0 | 145-274 | None |
| A0A654I117 | 288-434 | None |
| A0A1Y2HJ60 | 434-582 | None |
| A0A0P7GMD0 | 5-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.