DPCstruct | MC37253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 229 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6NP62 | 340-548 | DAIKTLIEIASEDGNMLRGSWFQILKCISEIEVLHLIKSEEVVDAAHFMNDQERAQISNVHTSSGSSLSRSYKTKLIQEHTKFTSKG… |
| A0A6J0PET4 | 447-670 | VDAVKAIISIAIEDGNYLQESWEHVLMCLSRFEHLHLLGEGAPLDASFFTGPLMESEEKSQKSPAIPPSKRKGNALQNPAVMAVVRG… |
| A0A0B0NWN5 | 1-224 | None |
| C1N7R0 | 6-257 | None |
| A0A6J8B818 | 2-234 | None |
| A0A0D2MC55 | 6-243 | None |
| A0A2P2LZ99 | 185-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.