DPCstruct | MC3725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 576 ± 94 aa |
| Standard deviation of domain lengths | 93.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00691 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5FRQ2 | 25-482 | ALCLAVAGCAEVESLRQRSATQESRIEALRQENEEFRANYYKIKEMYDAEVASSRKEIDRLTRELDEARNLKSQKEKELQDQLQSLQ… |
| V4JHQ4 | 82-654 | LTQQQTQQLASLQQQHDENMAEAAKANAEALAKLQDDLDSNVRATNELQQQFDALTAAKDQVDAALAEVKESESSLREQLADLQKTE… |
| A0A2G6CEK9 | 28-633 | None |
| A0A524N0G7 | 183-900 | None |
| A0A1I3Z6L3 | 140-776 | None |
| A0A251WYE6 | 5-717 | None |
| A0A4Q3DNB9 | 9-471 | None |
| A0A849TFJ4 | 597-1023 | None |
| A0A6L8GCZ2 | 104-720 | None |
| A0A495VCX8 | 371-848 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.