DPCstruct | MC37248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A3GY19 | 1-93 | MTETVLDEAARLIDGDRLGQYGKASESFERIGDLWSAYLGACLTPFDVANMMILLKVSRAKSGLDRGDVHRDSYVDIAGYAALAEQI… |
| A0A7D5GPV4 | 5-91 | EPEPSILAKADETVGQRAREYGPPTENFQVIADMWSGYLGIEITAYDYSQMMQLAKIGRTKTGSPDRDTHLDQAGYAQCTDLVYQDG |
| A0A661ZA53 | 5-94 | None |
| A0A1X7C3D9 | 105-196 | None |
| A0A5C7PAT4 | 4-93 | None |
| A0A0F9BX24 | 2-81 | None |
| A0A2G1WY52 | 16-112 | None |
| A0A2E0N190 | 111-198 | None |
| A0A2M8Q5N3 | 2-87 | None |
| A0A7I7SBU5 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.