DPCstruct | MC37247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 196 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3Z8W3 | 1-182 | MDWENLSALADRVAANIAREWGVVEKDDVKQEILAHAYEHRKAIEAVYPDEAFIWKIFRKAGHQYASRERDARDLLDDQYYYTPDEA… |
| A0A1A3GY22 | 1-202 | MTIDSLAPLIRRAAKAVAHQWPGVIEKDDAEQAIYLRLLETKGSIQKIALMDKDAKYRAIIGIGHQLASEERTDYDYYKGAYRYSVK… |
| A0A4R4MDL0 | 5-209 | None |
| A0A4Y4DIT4 | 24-225 | None |
| A0A291RTW1 | 1-167 | None |
| A0A543IQV2 | 5-203 | None |
| A0A2T9XMT3 | 1-228 | None |
| M3CEC6 | 5-223 | None |
| A0A4Y3QYD7 | 14-186 | None |
| D3CS68 | 33-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.