DPCstruct | MC37246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 145 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0MYU6 | 1-144 | MVALLIEHGPLSDDDIVQKLTAAGVADPESVLDEFGSAYDAPTGFLPDDRSVWLPALLASKVFTHRICADEITDDVLTVTPDLEPVA… |
| A0A6M6JA40 | 106-241 | ALAAAFVDLAREHGPVPIGELAVHMIARLDLHPDDAARLTDQAEERLHDDPDSPVVLLSPDLVVHVDALTEGIALTHRLSADERDGD… |
| X7YB97 | 1-163 | None |
| A0A0N9NIE8 | 3-140 | None |
| A0A810KTC5 | 46-190 | None |
| A0A1S1LBQ4 | 15-161 | None |
| A0A1V3WJR3 | 1-161 | None |
| A0A7I7NPR6 | 20-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.