DPCstruct | MC37244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 69.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09753 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MYF5 | 1-112 | MVFSKVEVNLRRLLEAAPRQQNQAKLVHYITTARELLEQLGAEITPEGISSVSKAKLSEYSEKIEALAATLASLVPENENLVDESRE… |
| A0A0V0I365 | 1-72 | MGLSKTEVNLKRLLVTAPQQQNQAKLIHYVATLRELLEQLAEERNPDGLPRISKAKVNEYAENIEAVAAKLA |
| A0A392MGG0 | 1-78 | None |
| A0A7J6DTC5 | 1-78 | None |
| A0A0D9XA65 | 1-72 | None |
| A0A811NJE6 | 3-85 | None |
| K3ZX21 | 1-109 | None |
| B9G2H9 | 125-198 | None |
| A0A166EFM3 | 4-73 | None |
| A0A7N0UIA0 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.