DPCstruct | MC37243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 73.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J9TRD6 | 1-77 | MVTEEALPTYQTMLNTLDGVRDETGASPTTWAVWTRAWTAEENRHGDLLNKYMYLTGRVDMKQIEKTIQYLIGSGMD |
| B8B2W7 | 1-86 | MVMEEALPTYQSMANWFESARDVTGADGTAWARWICRWSAEENRHGDVLNRYMYLSGRLDMRQVERTVHRLISSGMAMHAPVSDTV |
| A0A0E0JRT5 | 79-158 | None |
| A0A453MJD6 | 102-182 | None |
| A2XI50 | 1-79 | None |
| A0A6N2M1N3 | 135-211 | None |
| A0A453MJN7 | 1-65 | None |
| A0A2J8AHP9 | 133-209 | None |
| A0A7J8SR20 | 84-160 | None |
| D8S5B7 | 214-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.