DPCstruct | MC37241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 185 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N0HSX5 | 111-292 | MGSSGTIAYSDKSDFDFWLCYTPDLSETQIAELQQKAEAIEKWAETLGLEVHFFLMDAEKFRSGEKSELSKESSGSAQHNLLLDEFY… |
| B8B1P2 | 1-182 | MGSTSSIGQSCSSDLDIWVCHQSWLDNEERTRLQQKCSLLEKWAASMGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILLLDEFY… |
| A0A355B1N9 | 164-348 | None |
| A0A0B8PYN4 | 1-158 | None |
| A0A379X3H2 | 2-150 | None |
| A0A2A5CWB4 | 116-297 | None |
| A0A846QMY5 | 728-921 | None |
| Q1NKW5 | 103-302 | None |
| A0A3B0LZX6 | 102-297 | None |
| A0A6L2ZQ34 | 101-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.