DPCstruct | MC3724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 101 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A330M2P4 | 2-84 | AWLILVDETGRIIRDDKRGAISSNGANILIRLNISSDNWIKITSEFGKLFHGPVGTLQELTSYGEHLGKRRRHFAKCCQYLET |
| A0A7T8HYX9 | 67-167 | IPLMPFDATARTLWAVPFAFDDYLELVDWTGRALRSDKRGHIDARQPRILARLNIDGEQFISYADRLLKAFGTAICAPQALTSLCAR… |
| A0A7W4WAJ6 | 538-660 | None |
| A0A4Y7ZLT8 | 27-118 | None |
| A0A411Z876 | 23-123 | None |
| A0A1E4ZUM5 | 45-149 | None |
| A0A2S1JPK7 | 9-107 | None |
| A0A3L7V267 | 1-85 | None |
| A0A7W7Y6H7 | 16-122 | None |
| A0A1Y6KVI9 | 100-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.