DPCstruct | MC37237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 301 ± 49 aa |
| Standard deviation of domain lengths | 49.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7C839 | 1-220 | MSSLLFDCGVFIPIDCRKGIYYQLSGIPLSVLEPVNKPPREHDPSSKIAQTAESNSLLPAGAARNSKVQGNTEDHRRDISKPNSIVF… |
| A0A2T4AAV9 | 135-477 | EIIDFVIWRLFTRERGPWPKHILCDGFRRNAREDQSVRSTIPGTGIFSLYPNFHVMALREAPWPQLLALLGQAGERVMINLLSECSV… |
| S3D847 | 144-465 | None |
| A0A2I1CUE4 | 223-511 | None |
| A0A2W1F9P1 | 139-475 | None |
| A0A0C3E418 | 1-247 | None |
| A0A6A7BIN3 | 1-359 | None |
| A0A319DHY0 | 201-444 | None |
| A0A0E9NB64 | 77-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.