DPCstruct | MC37231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9JFR3 | 1-92 | QDATPLTLGQEFSGYVSQLDHGLGRLNDALQGLYELPLGGTAVGTGLNSHPDYAVTAAAELAALSGLPFITAPNKFEALAGRDACVY… |
| A0A497RDC0 | 1-89 | MPIPLEMEFAVYKEQLMKTKQRLESVLQELYLLLLGGTIFGTGLNASSQYTDYALANLRELTGFPFKTNSVKAEGIASHNSLAYLSS… |
| A0A5P1EU18 | 43-134 | None |
| A0A1V3XKV0 | 4-93 | None |
| A0A830C7X2 | 86-177 | None |
| A0A0D3BNG8 | 150-253 | None |
| A0A6S6S0B9 | 7-98 | None |
| A0A485CXT2 | 2-69 | None |
| A0A078JCQ5 | 1-101 | None |
| A0A5P1EC12 | 149-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.