DPCstruct | MC3723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 190 ± 39 aa |
| Standard deviation of domain lengths | 38.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3DBG9 | 4-144 | HFLAKTRIELSDCLPAGDMLAIERYETLSRLLEERAGTPVARLFAEPLISRGNDVASPTIAWYTDFEGTGIPWSDLDEEARGDLGDV… |
| A0A7T8HYC3 | 3-182 | TSLRIARVDVSAYRLPSADFAGLNALHRELDACIRHHLPATTASLLAMPVPAQDATLVDWYSDLAGEARPLSALPPSTRAQVKQKLA… |
| A0A5C8PQ87 | 19-231 | None |
| A0A4Q8XRE3 | 5-265 | None |
| A0A376FAM9 | 2-163 | None |
| A0A4Q5L2D7 | 4-192 | None |
| A0A080KA43 | 1-203 | None |
| A0A7T9EQI5 | 2-191 | None |
| A0A7H1NQD1 | 1-270 | None |
| A0A353VU14 | 7-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.