DPCstruct | MC37223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 11.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497B975 | 7-141 | FRGVKFLNATPHDVTVYDADGKTALFTIPRSGFVARLAEEVEDAGNIAGIPVVRKRYTQPYAIAGLAKRSLRELVEELVAEDYVNVV… |
| A0A345NLQ0 | 1-103 | MRLYVDETITATWEPEGLARVTDVLQEQTPLRTQDGDVPFLRISGDGSTTGLPAPEEGVVYLVSRLMAMAIERDDVVFPFDEHRDEQ… |
| A0A662ULC7 | 22-138 | None |
| A0A7D8YI13 | 150-276 | None |
| D3SGP0 | 29-150 | None |
| A0A3P1T6T5 | 497-609 | None |
| A0A2E8BUY3 | 2-116 | None |
| A0A847KMU8 | 3-119 | None |
| A0A3G5T744 | 4-121 | None |
| A0A839DP60 | 344-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.