DPCstruct | MC37222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133SJ36 | 4-55 | LDIYKGLVPFLGEALGKDCEVVLHDFREPGHSVIAIANGNISGRHVGAPATD |
| A0A2N2B570 | 3-47 | LVDFLAEFMGENTEVVLHDMTDWHHSVVAIRNGHISGRKVGDPIT |
| A0A7Z1TAT2 | 1-68 | None |
| A0A4Y3TI18 | 2-62 | None |
| A0A847NCC7 | 1-66 | None |
| G5S1W0 | 21-91 | None |
| A0A1G9YG22 | 2-68 | None |
| A0A377XJF0 | 21-81 | None |
| A0A4Q2WNI4 | 1-64 | None |
| A0A0J1F8G0 | 5-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.