DPCstruct | MC37210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 255 ± 56 aa |
| Standard deviation of domain lengths | 55.74 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561S3Q9 | 19-243 | EVPAAHVLEIATSLACSPHTAATRMAALGLRLPYTPEAADEVLLRISEVRSPRWLGRYTPPPLGHVLAVARETGRSPADVVARLEEL… |
| S4MX99 | 1-346 | MFPSPDVAQLVRWLHQSDIRLENGVSLRDLASVRSHNTPWEEMSWYADELREAGVDIPDAGSLLRAWDELPTPSRYAFSGEDPNWDG… |
| A0A5Q0GR39 | 26-236 | None |
| A0A841CN33 | 376-622 | None |
| A0A3E0I0E4 | 1-208 | None |
| A0A6I6NFQ3 | 1-215 | None |
| A0A3E0VWQ9 | 412-742 | None |
| A0A3E0VGN7 | 467-780 | None |
| A0A1V0ABH9 | 92-338 | None |
| A0A561UBC2 | 501-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.