DPCstruct | MC3721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9UMN0 | 38-171 | LDTFKPMVTGSKRKLITKSQLDQVEKYADKIFRSLDIDVEFTKHFLQRLNDARNKEQITTNELIDLFKRTRQEYGTKIKNLKPESEA… |
| A0A7C1ZPY2 | 4-132 | LRIAQDRAITKSELDVLEKKLDAIFIRVGIDIEFTKHFFERLNDPRNKEQITIEELSSLFNAEFKKYGKELAQLGLNKKDAEAIFKD… |
| A0A1Z9AXN3 | 167-290 | None |
| A0A2E9KRG7 | 6-127 | None |
| A0A094J1B7 | 39-142 | None |
| A0A2D5MSW5 | 1-127 | None |
| A0A1Z8SRR0 | 7-128 | None |
| A0A2D9C5W3 | 175-296 | None |
| A0A2E1GSA1 | 137-255 | None |
| A0A2E8NWI0 | 229-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.