DPCstruct | MC37206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00857 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1FLB0 | 2-88 | LRSQPYSWPCGGPLDASTTALVLIDMQHDFCGKGGYVDRMGYDISATRAPIKPLQRVLAAARAAGVRVIHTREGHRPSLADLPQNKR |
| W9W5V4 | 8-93 | SVIAEPYHYPHDASFGPATSAIVVIDMQRDFCEVGGYFDCQGYDVEDARSLIPTIQALLSAARRAGFPVFFTREGMEQHTKHQSLA |
| A0A1S9S0N4 | 2-94 | None |
| W3XJM5 | 20-113 | None |
| A0A533B7E9 | 3-90 | None |
| A0A0Q8QTX0 | 7-77 | None |
| A0A6N8Q8B6 | 2-77 | None |
| A0A1S8B573 | 7-96 | None |
| A0A1J1LF61 | 28-98 | None |
| A0A818ZXY0 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.