DPCstruct | MC37205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 335 ± 54 aa |
| Standard deviation of domain lengths | 54.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9W2Z7 | 1-389 | MVTGSTVDDSDDGSCYYTASLGEQSQEMSRTGSGHVETPSGDLPRLDDPFDGGLVDDHEDHLLELDTSFVRSTSRDPSSAPIDVAPR… |
| A0A2J6SDH9 | 3-281 | ETSLLLETNSSNNSRLLPETTFSRPRPTTDAANWDLPEMPIYPVVESRVIPGQIKGKEWISVEGKLRFEAQEAQLLSKWGVTPSHAG… |
| A0A094F0F5 | 1-433 | None |
| A0A1L7X266 | 61-457 | None |
| A0A5N5MXR1 | 76-368 | None |
| A0A3D8SXT8 | 301-583 | None |
| A0A4Q4YBT0 | 43-398 | None |
| A0A094DCR2 | 1-364 | None |
| A0A178ZK39 | 2-320 | None |
| A0A1C1CMD7 | 243-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.