DPCstruct | MC37203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6TLD8 | 13-164 | AIEELLRMASNAQTPRTDSAEVQRWKGLFEYSHFEAIYLLQEFLNDVNRYRMADSEYELMAAVLAANGHSRLSWEHLNSLKHMLDTQ… |
| W9VWT1 | 18-171 | SECIVSDADIARWQRLFNFTKSEAVRRIEDYRNDYTKTRTSEELWTTIRPTKEGGRLRPRKPKKAQHQQDTSGTYLLRLEGPLDTAQ… |
| A0A0D2HD80 | 8-151 | None |
| A0A132BCL2 | 1-156 | None |
| A0A093XT97 | 2-123 | None |
| A0A2V1D9L4 | 61-235 | None |
| A0A2H1FWZ0 | 434-620 | None |
| A0A2J6PHL2 | 1-145 | None |
| A0A4U6X6I0 | 1-170 | None |
| A0A428S229 | 9-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.