DPCstruct | MC37200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R9DY19 | 153-236 | AVESSSKVTAIGDSVMLAAAPALMAALPGIDIDAEVGRQLSLVGREVAAFKQRHALADTVVIGLDTNGLGGEKDLQAVVDAIGT |
| A0A2X0ZQ45 | 3-71 | TGDQITAIGDSVMLASSQGLSAVFPGIQIDAAVSRSIMVAPGMVNNDLNAGTLRSWVILGLATNSAIST |
| A0A835G3X9 | 330-424 | None |
| A0A3A9BKD8 | 296-381 | None |
| A0A7X8DGM6 | 25-107 | None |
| A0A2N6SVM8 | 301-372 | None |
| A0A7T9IX50 | 128-222 | None |
| A0A6J7JHN5 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.