DPCstruct | MC372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109K5K6 | 1-173 | MLSERQFLFLREAALQLQYALDAFEEFARLKQSSARPDTLFKALDDFLDHAARVEAVFWPTKKYFARGQELRELLSVKDDNYLHNHE… |
| A0A2V9PJ59 | 1-174 | MQRLDWMFLMELQRQCRFTLLAASEIHNAMHESDGTRKPTDMTQFWYNIQGLLGAVGNVSKILWPPAKRCQPRGSRLRALLSVADTS… |
| A0A1W6DLU4 | 27-245 | None |
| A0A837GFH2 | 4-177 | None |
| A0A7W5ATB9 | 7-207 | None |
| A0A1H9EAV7 | 59-257 | None |
| F2IUL1 | 15-195 | None |
| A0A4R3RTZ0 | 1-205 | None |
| A0A1Y4R447 | 13-205 | None |
| A0A5A7MTZ4 | 1-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.