DPCstruct | MC37198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372KMR2 | 1-83 | MWTELRLREADAEEREFFGSDWVWNGPVPEEDERVLVSNGIDVWIDTWVYADSQNAGLENEPDGGNGLFWAPLPEPPKVKNGR |
| A0A081R379 | 4-85 | TDWKKITQRPLTSEEKKEYGDEVEFMWDGKTPEFDEEVLVYTSESEEVYTDIWVDFNDGIGFENTCSNVIYWMSFPKPPEIT |
| A0A7W4E740 | 5-93 | None |
| A0A2T0FU72 | 1-84 | None |
| A0A0R1TKH2 | 87-172 | None |
| A0A0R1TDM3 | 100-185 | None |
| A0A2S0L5X6 | 67-149 | None |
| A0A7U6QHU9 | 89-161 | None |
| A0A417QGY4 | 133-220 | None |
| A0A1F0KA60 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.