DPCstruct | MC37197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370NGY6 | 42-114 | SRDFIRQELVYGGRSGNTIDVAYREFRGGYATPAFYQSLKYDLSASTRIRFQKFTIDVVRADNENIVYKIASD |
| A0A2P1ASR2 | 1-85 | MKTVAIASDNSFQQTLIYSGKFGNKINVGYREFSSNQARPAFNNDVEYDLSQSKQIGYKGALLEVIDATNQDITYKVLKNFNKVD |
| A0A2E0W8M2 | 66-138 | None |
| A0A430HR51 | 59-144 | None |
| A0A657APL3 | 132-203 | None |
| A0A1G4UC68 | 14-96 | None |
| A0A0H3GKI4 | 2-73 | None |
| A0A258IWL1 | 136-209 | None |
| A0A7W3DA65 | 47-132 | None |
| A0A809R007 | 58-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.