DPCstruct | MC37185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8VW58 | 1-85 | MAYPSYFQFPIVPNHLHSINDSVSAEEAADEYIDCPKLDLILLGIGPDHHVASLCSNHSALKETDKWVTFIIDFPKPPPERITFT |
| A0A0D3H2V4 | 264-361 | PIPASQIYAINDTLSAEGAADEYETCLKQLVNDGVVAISEVTGFPKLDLMLLGMGPDGHVGSLFPGHPIVNENQKWVSYIKDSPKPP… |
| A0A6P7TY23 | 51-133 | None |
| A0A7J7QSQ9 | 807-904 | None |
| A0A146IEE7 | 98-193 | None |
| A0A409XY26 | 335-430 | None |
| M7YA95 | 109-206 | None |
| A0A3Q0JJK2 | 75-165 | None |
| A0A7N0T142 | 1-92 | None |
| A0A4U5R101 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.