DPCstruct | MC37184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 57.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HES0 | 15-156 | LFGLYVCYLSFNQIRMESKHAEENGAQDQNEHVCAKPYVPSEELPYVHFPKPKGYSRAECSCNPVRFFVIMSMQRSGSGWFETLLNS… |
| A0A6A3C5S5 | 352-471 | EFLNIGVIQKPCLEPNIEPWEIPYMHHPNPKTFSRVECACNPVRYFAIMSMQRSGSGWFETLLNNHTNITSNGEIFSVKVRRTNVWT… |
| A0A6P6TFV1 | 34-175 | None |
| A0A1D6QKN5 | 32-179 | None |
| A0A4S8ING0 | 324-462 | None |
| A0A287FW67 | 1-159 | None |
| A0A1Y1I0Q7 | 159-275 | None |
| A0A0D2PCU9 | 25-182 | None |
| A0A453FPL7 | 49-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.