DPCstruct | MC37180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1D853 | 125-248 | THQPSESELGQYVDRLLGKSIIELAQQFQASGIVLPHTQNLREHLAAEINARAERKSDSKQVQNKYAKQARISIHRWSYDRLLTAIR… |
| A0A140K1T9 | 2-104 | ELAQQDRVSAIAVPKIEDIREITQAEIKAKAEAKIPGYEEGQKKYALAYRINIHNWSYGRLIENISTQANKLGIAIVEVKQPIRGSP… |
| A0A0D6ACB2 | 484-604 | None |
| A0A2T1CUA9 | 323-448 | None |
| A0A7Y3TUB6 | 637-760 | None |
| A0A2K8WR38 | 18-120 | None |
| A0A235J292 | 157-282 | None |
| A0A4Q7E9B5 | 416-528 | None |
| B7JWD4 | 553-677 | None |
| A0A2H2XQY1 | 74-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.