DPCstruct | MC3717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 242 ± 36 aa |
| Standard deviation of domain lengths | 36.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1W8A6 | 1-197 | MSLRIDDVGAGEEVTTAAISPEVYSFGGRRRGVQRLLRYRQGERVILVPTIEMVRYLFLHNKTMANALMCPDGIMEFYCPEEPGFHS… |
| A0A811AR26 | 20-287 | FRNSGHKEWRIFVWFNPMQERKWTRFTHLPLLSRAKVVNSTTKQINKADRVIEFEASDLQRAKIIDFPNLSSFASVRNKDGAQSSFI… |
| A0A844D8Z9 | 1-235 | None |
| A0A891X5F0 | 33-322 | None |
| A0A515EUV1 | 15-210 | None |
| A0A1M6QFS4 | 4-258 | None |
| A0A1B5EWF1 | 13-245 | None |
| A0A7H1MIT9 | 5-327 | None |
| A0A7U1GLW6 | 3-182 | None |
| A0A072XA31 | 29-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.