DPCstruct | MC37165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3NCB5 | 1-185 | MGDEQKALDQLERLGFDNLSKKDQKVMLSLYEETGQPEKAINLKPEYAEEVVNDLISNQKYDDLRTLQSKIDNPVVNYEVAFLDKKW… |
| A0A5B8PS68 | 1-182 | MSVFSLYTVPSNPVEARTSQPDTHLVKGLQQASIQQYPKAIQEFEKLDYKELDKESQKAVLFSYLLSGKANKALQYEPKFAESVVSY… |
| A0A1S2MG19 | 167-373 | None |
| A0A4R3L6Z8 | 230-399 | None |
| A0A4U2WQ74 | 92-288 | None |
| A0A2G5VZG5 | 274-440 | None |
| A0A243MCG9 | 409-570 | None |
| A0A6D1SVA2 | 537-688 | None |
| C2UNC1 | 3-191 | None |
| E7CGS5 | 41-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.