DPCstruct | MC37158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 551 |
|---|---|
| Mean domain length (aa) | 161 ± 25 aa |
| Standard deviation of domain lengths | 24.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.02 |
| Pfam Score | 99.37 |
| Assigned Pfam label(s) | CL0363- CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8B505 | 15-166 | FLIHTITATTTTPALVYRGDTRSPETIEQSGGFHSRAASLGLAEDYSVTPVEHVKISSSDRRYLHDPWISTGKSRKSTYFFISVRQE… |
| A0A7S9U7X6 | 4-127 | KETITYRGDSRDPNTIFNEGFQPWGDSNDLFKHASDNTSPPSNFISTSKSPEVAAEFGSQLYTESGYVYAIRSNNGIDVNSVLGKAT… |
| A0A3G7U5N1 | 13-184 | None |
| A0A084U430 | 7-169 | None |
| K3WHV6 | 14-124 | None |
| A0A3E1NMW8 | 262-399 | None |
| A0A3N4KM83 | 638-801 | None |
| A0A0D2FA54 | 121-294 | None |
| A0A0S7DRC6 | 143-255 | None |
| A0A2H4S8B2 | 10-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.