DPCstruct | MC37154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 441 ± 41 aa |
| Standard deviation of domain lengths | 40.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3SHX3 | 1-416 | MHKEDDIFGSVNVGFLGTKLFLRVLTEDTEKFEEWVRGKYKCKPCPQFVRHLNRFFEPKQLEALGIRFELLIQRPGDLIETKTNQYH… |
| B2B2P9 | 227-646 | TEGHFPGVSSLYGHIGEAMSGTAFHCEDANLRSYNLTLIGWKTWILIEPSHTLAFKQLIRRLHPHPSQCDQFVRHSALLIHPDKLRS… |
| J3PII1 | 335-763 | None |
| A0A2K0W6J1 | 120-559 | None |
| A0A430LI89 | 140-652 | None |
| A0A0D9NJC2 | 332-727 | None |
| A0A0N0V529 | 405-812 | None |
| A0A3M2SNN3 | 399-901 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.