DPCstruct | MC37152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 156 ± 29 aa |
| Standard deviation of domain lengths | 28.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A633MX03 | 1-157 | MSNIDKQALRKVAEKATPGNWHRSSSRFNGITATPFSLCGEEVMLAHTVEKRDAEFIAAANPATMLALLDENIQLQREKDATEAVAL… |
| A0A708ACY8 | 1-153 | MTALNKQALREVAEKATKGPWKVFSDIDTKTFSIHTPRDKRCENVIKWGGFDCQPNAEANAEFIAAFNPKVALALLDELDHYKSREE… |
| A0A4R1IWI0 | 1-154 | None |
| A0A5U3KX88 | 2-162 | None |
| A0A6C0NDY5 | 103-238 | None |
| A0A8B4J4Q2 | 76-243 | None |
| A0A376DID2 | 2-91 | None |
| A0A0M3F798 | 1-176 | None |
| A0A761WYJ5 | 1-174 | None |
| A0A7I6ZJ10 | 31-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.