DPCstruct | MC37149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843GCS7 | 124-247 | RMPAKDQLSIDISPSYVVTGNHPVVMRESLLPQAFEIGDKLVKSAAELVKPGLNGPFCIQTLVNDNLEVVVFETSARTDGGTNTFME… |
| A0A836BLP1 | 1-107 | MIANSPLVLRESLLDEVYSMGERFVDASKKLVKPGMNGPFCIEGVYDENANFKTFEFSARIVAGTNIFMSGSPYTYLIYDEPMSMGR… |
| A0A133VP17 | 2-109 | None |
| A0A7J2HFI8 | 21-154 | None |
| A0A7J3VUD1 | 3-127 | None |
| A0A7J2I4G1 | 100-246 | None |
| A0A832UVV6 | 2-89 | None |
| A0A256ZUW9 | 10-149 | None |
| A0A1D2R3G5 | 343-483 | None |
| A0A6V8CST5 | 62-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.