DPCstruct | MC37147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836BIH8 | 119-174 | MIVESEINCDPSYPTVCIPPWPPDLDCGEIRYVNFEVLQDDPHGFDGDKNGIGCES |
| A0A355DP48 | 21-77 | PSPSPSQVQCDRAYPGVCIPSPPPDLDCKDIQYRNFTVLPPDPHNFDGGGDGIGCEQ |
| A0A7V9SEB8 | 102-167 | None |
| A0A534LP73 | 90-145 | None |
| A0A846BUI5 | 245-310 | None |
| A0A419HBK8 | 61-124 | None |
| A0A0G0TRI0 | 113-171 | None |
| A0A7W0MZV4 | 161-218 | None |
| A0A7J9QL44 | 364-419 | None |
| A0A832H1S2 | 3-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.