DPCstruct | MC37146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 500 ± 73 aa |
| Standard deviation of domain lengths | 73.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0FN79 | 1-499 | MNQPEATKLTALRLPKNTIDTVNPRPSNEGYSAEFYGNRSNEGVDFLSLIRFIKKASTNPQCIFNWKDFERAPIVQTYSTRDGEGGT… |
| A0A3G6MRI4 | 92-573 | YELLAKDLKEKLGLINSFLFEPEKYLLEDKTIYSGSSSFSTPVFSSVKNNKPFLYKKNDTEVQAIFDLAKLNTRKNLLSNSYNFGIY… |
| A0A411DRH6 | 14-568 | None |
| A0A6N4ABK5 | 78-457 | None |
| A0A1N6REQ9 | 3-555 | None |
| A0A3G6TTE3 | 17-518 | None |
| A0A6J4GUP1 | 600-1011 | None |
| A0A085ZX64 | 1-620 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.